PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10018493
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 221aa    MW: 25491.2 Da    PI: 9.8418
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10018493genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF46.16.3e-151055651
                 HHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  6 ksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 k ++  +++k r g+ KKA+ELS  C+++v +i+fs++gkl ++++
  Lus10018493 10 KKKKVSSYCKQRDGMVKKANELSEQCGVDVGLIMFSPKGKLTTFAT 55
                 5566679*************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006614.801157IPR002100Transcription factor, MADS-box
SMARTSM004323.7E-11156IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.32E-16570IPR002100Transcription factor, MADS-box
PfamPF003191.3E-141053IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-71934IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-73455IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MARRKFFMKK KKKVSSYCKQ RDGMVKKANE LSEQCGVDVG LIMFSPKGKL TTFATKGRIE  60
DVFLRYIERS DEIESQEENL YRSLKQLRHE GEVLEKLARI EALEEELQEL NKQQSQKEEQ  120
LKCYNLDVQK IGSISEALLH QQFLTNAIQN IQRLKLQQNL INQIKLRNPA NFEVAGLTAK  180
ESIEKQRNQA GDYGGSSSGG PHLSLEFLKK QQHWNLRINH *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1753967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77980.14e-16AGAMOUS-like 66